PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1707_a_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 155aa    MW: 17043.3 Da    PI: 10.1663
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1707_a_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.49.1e-245299148
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
            SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
                   +Cqve+C+ad+s+ak+yhrrhkvCe+h+ka+vv v+gl+qrfCqqCs 
  Neem_1707_a_2 52 TCQVENCTADFSDAKKYHRRHKVCEFHAKAAVVRVAGLQQRFCQQCSS 99
                   6*********************************************95 PP

2SBP35.13.5e-111211465277
                    TTT--SS--S-STTTT-------S-- CS
            SBP  52 lsefDeekrsCrrrLakhnerrrkkq 77 
                     ++fD++krsCrrrLa+hnerrrk +
  Neem_1707_a_2 121 TTKFDDTKRSCRRRLAGHNERRRKGA 146
                    579********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-2446132IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.12850145IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.12E-2852145IPR004333Transcription factor, SBP-box
PfamPF031108.4E-195399IPR004333Transcription factor, SBP-box
PfamPF031102.6E-5121144IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDTSKAEGKR SLKEVVEDXX XXXXXDVVGF GDDDKKKKGK RVSSGAGGSS ITCQVENCTA  60
DFSDAKKYHR RHKVCEFHAK AAVVRVAGLQ QRFCQQCSSN GSIPSHGGQT VPSIAISNKQ  120
TTKFDDTKRS CRRRLAGHNE RRRKGAAEYH GEGLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2843144284squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025578.15e-50Squamosa promoter binding protein-like 3
SwissprotQ387412e-39SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A061GEC85e-50A0A061GEC8_THECC; Squamosa promoter-binding-like protein
STRINGVIT_10s0003g00050.t016e-41(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-34squamosa promoter binding protein-like 3